AWAT1_HUMAN   Q58HT5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q58HT5

Recommended name:Acyl-CoA wax alcohol acyltransferase 1

EC number:EC:2.3.1.75

Alternative names:(Diacylglycerol O-acyltransferase 2-like protein 3) (Diacylglycerol acyltransferase 2) (Long-chain-alcohol O-fatty-acyltransferase 1)

Cleaved into:

GeneID:158833

Gene names  (primary ):AWAT1

Gene names  (synonym ):DGA2 DGAT2L3

Gene names  (ORF ):

Length:328

Mass:37759

Sequence:MAHSKQPSHFQSLMLLQWPLSYLAIFWILQPLFVYLLFTSLWPLPVLYFAWLFLDWKTPERGGRRSAWVRNWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPFVREYLMAKGVCSVSQPAINYLLSHGTGNLVGIVVGGVGEALQSVPNTTTLILQKRKGFVRTALQHGAHLVPTFTFGETEVYDQVLFHKDSRMYKFQSCFRRIFGFYCCVFYGQSFCQGSTGLLPYSRPIVTVVGEPLPLPQIEKPSQEMVDKYHALYMDALHKLFDQHKTHYGCSETQKLFFL

Tissue specificity:Predominantly expressed in skin, where it is limited to the sebaceous gland. Expressed in more mature, centrally located cells just before their rupture and sebum release. Also expressed in all tissues except spleen. Expressed at higher level in thymus, prostate and testis. {ECO:0000269|PubMed:15671038}.

Induction:

Developmental stage:

Protein families:Diacylglycerol acyltransferase family


   💬 WhatsApp