U17L6_HUMAN   Q6QN14


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6QN14

Recommended name:Ubiquitin carboxyl-terminal hydrolase 17-like protein 6

EC number:EC:3.4.19.12

Alternative names:(Deubiquitinating enzyme 17-like protein 6) (Ubiquitin thioesterase 17-like protein 6) (Ubiquitin-specific-processing protease 17-like protein 6)

Cleaved into:

GeneID:

Gene names  (primary ):USP17L6P

Gene names  (synonym ):USP17C USP17D USP17N

Gene names  (ORF ):

Length:398

Mass:44690

Sequence:MEDDSLYLRGEWQFNHFSKLTSSRPDAAFAEIQRTSLPEKSPLSCETRVDLCDDLAPVARQLAPREKLPLSSRRPAAVGAGLQNMGNTCYVNASLQCLTYTPPLANYMLSREHSQTCHRHKGCMLCTMQAHITRALHNPGHVIQPSQALAAGFHRGKQEDAHEFLMFTVDAMKKACLPGHKQVDHHSKDTTLIHQIFGGYWRSQIKCLHCHGISDTFDPYLDIALDIQAAQSVQQALEQLVKPEELNGENAYHCGVCLQRAPASKTLTLHTSAKVLILVLKRFSDVTGNKIAKNVQYPECLDMQPYMSQQNTGPLVYVLYAVLVHAGWSCHNGHYFSYVKAQEGQWYKMDDAEVTASSITSVLSQQAYVLFYIQKSEWERHSESVSRGREPRALGSED

Tissue specificity:

Induction:

Developmental stage:

Protein families:Peptidase C19 family, USP17 subfamily


   💬 WhatsApp