NT5M_HUMAN Q9NPB1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NPB1
Recommended name：5'(3')-deoxyribonucleotidase, mitochondrial
EC number：EC:3.1.3.-
Alternative names：(Deoxy-5'-nucleotidase 2) (dNT-2)
Cleaved into：
GeneID：56953
Gene names (primary )：NT5M
Gene names (synonym )：DNT2
Gene names (ORF )：
Length：228
Mass：25862
Sequence：MIRLGGWCARRLCSAAVPAGRRGAAGGLGLAGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRPC
Tissue specificity：Highly expressed in heart, brain and skeletal muscle. Detected at very low levels in kidney and pancreas. {ECO:0000269|PubMed:10899995}.
Induction：
Developmental stage：
Protein families：5'(3')-deoxyribonucleotidase family