NT5M_HUMAN   Q9NPB1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NPB1

Recommended name:5'(3')-deoxyribonucleotidase, mitochondrial

EC number:EC:3.1.3.-

Alternative names:(Deoxy-5'-nucleotidase 2) (dNT-2)

Cleaved into:

GeneID:56953

Gene names  (primary ):NT5M

Gene names  (synonym ):DNT2

Gene names  (ORF ):

Length:228

Mass:25862

Sequence:MIRLGGWCARRLCSAAVPAGRRGAAGGLGLAGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRPC

Tissue specificity:Highly expressed in heart, brain and skeletal muscle. Detected at very low levels in kidney and pancreas. {ECO:0000269|PubMed:10899995}.

Induction:

Developmental stage:

Protein families:5'(3')-deoxyribonucleotidase family


   💬 WhatsApp