DHDDS_HUMAN   Q86SQ9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q86SQ9

Recommended name:Dehydrodolichyl diphosphate synthase complex subunit DHDDS

EC number:EC:2.5.1.87

Alternative names:(Cis-isoprenyltransferase) (CIT) (Cis-IPTase) (Cis-prenyltransferase subunit hCIT) (Epididymis tissue protein Li 189m)

Cleaved into:

GeneID:79947

Gene names  (primary ):DHDDS

Gene names  (synonym ):HDS

Gene names  (ORF ):

Length:333

Mass:38657

Sequence:MSWIKEGELSLWERFCANIIKAGPMPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKRSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDPSDISESLLDKCLYTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQPVLWPEYTFWNLFEAILQFQMNHSVLQKARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARREERVQGFLQALELKRADWLARLGTASA

Tissue specificity:Expressed at high levels in testis and kidney. Expressed in epididymis (at protein level). Slightly expressed in heart, spleen and thymus. {ECO:0000269|PubMed:20736409}.

Induction:

Developmental stage:

Protein families:UPP synthase family


   💬 WhatsApp