MARH8_HUMAN   Q5T0T0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5T0T0

Recommended name:E3 ubiquitin-protein ligase MARCHF8

EC number:EC:2.3.2.27

Alternative names:(Cellular modulator of immune recognition) (c-MIR) (Membrane-associated RING finger protein 8) (Membrane-associated RING-CH protein VIII) (MARCH-VIII) (RING finger protein 178) (RING-type E3 ubiquitin transferase MARCHF8)

Cleaved into:

GeneID:220972

Gene names  (primary ):MARCHF8

Gene names  (synonym ):MARCH8 MIR RNF178

Gene names  (ORF ):

Length:291

Mass:32965

Sequence:MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNISKAGSPPSASAPAPVSSFSRTSITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLRKWEKLQMTSSERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGQATGILEWPFWTKLVVVAIGFTGGLLFMYVQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHGYGICHSDTNSSCCTEPEDTGAEIIHV

Tissue specificity:Broadly expressed. Present in immature dendritic cells (at protein level). {ECO:0000269|PubMed:12582153, ECO:0000269|PubMed:14722266}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp