RAC1_HUMAN P63000
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P63000
Recommended name：Ras-related C3 botulinum toxin substrate 1
EC number：EC:3.6.5.2
Alternative names：(Cell migration-inducing gene 5 protein) (Ras-like protein TC25) (p21-Rac1)
Cleaved into：
GeneID：5879
Gene names (primary )：RAC1
Gene names (synonym )：TC25
Gene names (ORF )：MIG5
Length：192
Mass：21450
Sequence：MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
Tissue specificity：Isoform B is predominantly identified in skin and epithelial tissues from the intestinal tract. Its expression is elevated in colorectal tumors at various stages of neoplastic progression, as compared to their respective adjacent tissues.
Induction：
Developmental stage：
Protein families：Small GTPase superfamily, Rho family