CDK4_HUMAN   P11802


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P11802

Recommended name:Cyclin-dependent kinase 4

EC number:EC:2.7.11.22

Alternative names:(Cell division protein kinase 4) (PSK-J3)

Cleaved into:

GeneID:1019

Gene names  (primary ):CDK4

Gene names  (synonym ):

Gene names  (ORF ):

Length:303

Mass:33730

Sequence:MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

Tissue specificity:

Induction:

Developmental stage:

Protein families:Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily


   💬 WhatsApp