PCY1B_HUMAN   Q9Y5K3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y5K3

Recommended name:Choline-phosphate cytidylyltransferase B

EC number:EC:2.7.7.15

Alternative names:(CCT-beta) (CTP:phosphocholine cytidylyltransferase B) (CCT B) (CT B) (Phosphorylcholine transferase B)

Cleaved into:

GeneID:9468

Gene names  (primary ):PCYT1B

Gene names  (synonym ):CCTB

Gene names  (ORF ):

Length:369

Mass:41940

Sequence:MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHEKLTIAQARLGTPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWKQMFQERSSRMLQALSPKQSPVSSPTRSRSPSRSPSPTFSWLPLKTSPPSSPKAASASISSMSEGDEDEK

Tissue specificity:[Isoform 1]: Highly expressed in testis, placenta, brain, ovary, liver and fetal lung. {ECO:0000269|PubMed:10480912, ECO:0000269|PubMed:9593753}.; [Isoform 2]: Expressed in brain, liver and fetal lung. {ECO:0000269|PubMed:10480912}.

Induction:

Developmental stage:

Protein families:Cytidylyltransferase family


   💬 WhatsApp