PCY1B_HUMAN Q9Y5K3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Y5K3
Recommended name：Choline-phosphate cytidylyltransferase B
EC number：EC:2.7.7.15
Alternative names：(CCT-beta) (CTP:phosphocholine cytidylyltransferase B) (CCT B) (CT B) (Phosphorylcholine transferase B)
Cleaved into：
GeneID：9468
Gene names (primary )：PCYT1B
Gene names (synonym )：CCTB
Gene names (ORF )：
Length：369
Mass：41940
Sequence：MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHEKLTIAQARLGTPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWKQMFQERSSRMLQALSPKQSPVSSPTRSRSPSRSPSPTFSWLPLKTSPPSSPKAASASISSMSEGDEDEK
Tissue specificity：[Isoform 1]: Highly expressed in testis, placenta, brain, ovary, liver and fetal lung. {ECO:0000269|PubMed:10480912, ECO:0000269|PubMed:9593753}.; [Isoform 2]: Expressed in brain, liver and fetal lung. {ECO:0000269|PubMed:10480912}.
Induction：
Developmental stage：
Protein families：Cytidylyltransferase family