CAH5A_HUMAN   P35218


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P35218

Recommended name:Carbonic anhydrase 5A, mitochondrial

EC number:EC:4.2.1.1

Alternative names:(Carbonate dehydratase VA) (Carbonic anhydrase VA) (CA-VA)

Cleaved into:

GeneID:763

Gene names  (primary ):CA5A

Gene names  (synonym ):CA5

Gene names  (ORF ):

Length:305

Mass:34750

Sequence:MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS

Tissue specificity:

Induction:

Developmental stage:

Protein families:Alpha-carbonic anhydrase family


   💬 WhatsApp