TOPK_HUMAN Q96KB5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96KB5
Recommended name：Lymphokine-activated killer T-cell-originated protein kinase
EC number：EC:2.7.12.2
Alternative names：(Cancer/testis antigen 84) (CT84) (MAPKK-like protein kinase) (Nori-3) (PDZ-binding kinase) (Spermatogenesis-related protein kinase) (SPK) (T-LAK cell-originated protein kinase)
Cleaved into：
GeneID：55872
Gene names (primary )：PBK
Gene names (synonym )：TOPK
Gene names (ORF )：
Length：322
Mass：36085
Sequence：MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV
Tissue specificity：Expressed in the testis and placenta. In the testis, restrictedly expressed in outer cell layer of seminiferous tubules. {ECO:0000269|PubMed:10781613, ECO:0000269|PubMed:11378444}.
Induction：
Developmental stage：
Protein families：Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase subfamily