ELNE_HUMAN   P08246


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P08246

Recommended name:Neutrophil elastase

EC number:EC:3.4.21.37

Alternative names:(Bone marrow serine protease) (Elastase-2) (Human leukocyte elastase) (HLE) (Medullasin) (PMN elastase)

Cleaved into:

GeneID:1991

Gene names  (primary ):ELANE

Gene names  (synonym ):ELA2

Gene names  (ORF ):

Length:267

Mass:28518

Sequence:MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH

Tissue specificity:Bone marrow cells. Neutrophil (PubMed:10947984). {ECO:0000269|PubMed:10947984}.

Induction:

Developmental stage:

Protein families:Peptidase S1 family, Elastase subfamily


   💬 WhatsApp