TRY1_HUMAN   P07477


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P07477

Recommended name:Trypsin-1

EC number:EC:3.4.21.4

Alternative names:(Beta-trypsin) (Cationic trypsinogen) (Serine protease 1) (Trypsin I)

Cleaved into:Alpha-trypsin chain 1; Alpha-trypsin chain 2

GeneID:5644

Gene names  (primary ):PRSS1

Gene names  (synonym ):TRP1 TRY1 TRYP1

Gene names  (ORF ):

Length:247

Mass:26558

Sequence:MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS

Tissue specificity:

Induction:

Developmental stage:

Protein families:Peptidase S1 family


   💬 WhatsApp