SAST_HUMAN Q9NV23
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NV23
Recommended name：S-acyl fatty acid synthase thioesterase, medium chain
EC number：EC:3.1.2.14
Alternative names：(Augmented in rheumatoid arthritis 1) (AURA1) (Oleoyl-ACP hydrolase) (Thioesterase 2) (TE2) (Thioesterase II) (Thioesterase domain-containing protein 1)
Cleaved into：
GeneID：55301
Gene names (primary )：OLAH
Gene names (synonym )：THEDC1
Gene names (ORF )：
Length：265
Mass：29931
Sequence：MERGDQPKRTRNENIFNCLYKNPEATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQPEPLHLFLSSATPVHSKAWHRIPKDDELSEEQISHYLMEFGGTPKHFAEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLDPANEKLIKNYIIKCLEVSSISNF
Tissue specificity：Detected both in lactating and non-lactating breast epithelium (at protein level) (PubMed:6589427). Isoform 2 is up-regulated in bone marrow-derived mononuclear cells of rheumatoid arthritis patients (PubMed:17082220). {ECO:0000269|PubMed:17082220, ECO:0000269|PubMed:6589427}.
Induction：
Developmental stage：
Protein families：Thioesterase family