ABEC1_HUMAN   P41238


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P41238

Recommended name:C->U-editing enzyme APOBEC-1

EC number:EC:3.5.4.36

Alternative names:(Apolipoprotein B mRNA-editing enzyme 1) (HEPR) (mRNA(cytosine(6666)) deaminase 1)

Cleaved into:

GeneID:339

Gene names  (primary ):APOBEC1

Gene names  (synonym ):

Gene names  (ORF ):

Length:236

Mass:28192

Sequence:MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNFIKKFTSERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWHMDQQNRQGLRDLVNSGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWR

Tissue specificity:Expressed exclusively in the small intestine.

Induction:

Developmental stage:

Protein families:Cytidine and deoxycytidylate deaminase family


   💬 WhatsApp