ABC3H_HUMAN   Q6NTF7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6NTF7

Recommended name:DNA dC->dU-editing enzyme APOBEC-3H

EC number:EC:3.5.4.38

Alternative names:(APOBEC-related protein 10) (ARP-10) (Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3H) (A3H)

Cleaved into:

GeneID:164668

Gene names  (primary ):APOBEC3H

Gene names  (synonym ):

Gene names  (ORF ):

Length:200

Mass:23532

Sequence:MALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICFINEIKSMGLDETQCYQVTCYLTWSPCSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPEFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKIPGVRAQGRYMDILCDAEV

Tissue specificity:Expressed in lymphoid organs. Also detected in non-lymphoid tissues including lung, testis, ovary, fetal liver and skin. {ECO:0000269|PubMed:16571802, ECO:0000269|PubMed:20308164}.

Induction:

Developmental stage:

Protein families:Cytidine and deoxycytidylate deaminase family


   💬 WhatsApp