ALKB6_HUMAN   Q3KRA9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3KRA9

Recommended name:Alpha-ketoglutarate-dependent dioxygenase alkB homolog 6

EC number:EC:1.14.11.-

Alternative names:(Alkylated DNA repair protein alkB homolog 6)

Cleaved into:

GeneID:84964

Gene names  (primary ):ALKBH6

Gene names  (synonym ):ABH6

Gene names  (ORF ):

Length:238

Mass:26483

Sequence:MEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLSGRKLQNWGGLPHPRGMVPERLPPWLQRYVDKVSNLSLFGGLPANHVLVNQYLPGEGIMPHEDGPLYYPTVSTISLGSHTVLDFYEPRRPEDDDPTEQPRPPPRPTTSLLLEPRSLLVLRGPAYTRLLHGIAAARVDALDAASSPPNAAACPSARPGACLVRGTRVSLTIRRVPRVLRAGLLLGK

Tissue specificity:Widely expressed, with highest expression in testis and pancreas. {ECO:0000269|PubMed:17979886}.

Induction:

Developmental stage:

Protein families:AlkB family


   💬 WhatsApp