ALKB1_HUMAN   Q13686


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q13686

Recommended name:Nucleic acid dioxygenase ALKBH1

EC number:EC:1.14.11.-

Alternative names:(Alkylated DNA repair protein alkB homolog 1) (Alpha-ketoglutarate-dependent dioxygenase ABH1) (DNA 6mA demethylase) (DNA N6-methyl adenine demethylase ALKBH1) (DNA lyase ABH1) (DNA oxidative demethylase ALKBH1) (mRNA N(3)-methylcytidine demethylase)

Cleaved into:

GeneID:8846

Gene names  (primary ):ALKBH1

Gene names  (synonym ):ABH ABH1 ALKBH

Gene names  (ORF ):

Length:389

Mass:43832

Sequence:MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSGFSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPDS

Tissue specificity:Ubiquitous. {ECO:0000269|PubMed:17979886, ECO:0000269|PubMed:18603530}.

Induction:

Developmental stage:

Protein families:AlkB family


   💬 WhatsApp