MIOX_HUMAN   Q9UGB7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UGB7

Recommended name:Inositol oxygenase

EC number:EC:1.13.99.1

Alternative names:(Aldehyde reductase-like 6) (Kidney-specific protein 32) (Myo-inositol oxygenase) (MI oxygenase) (Renal-specific oxidoreductase)

Cleaved into:

GeneID:55586

Gene names  (primary ):MIOX

Gene names  (synonym ):ALDRL6 KSP32 RSOR

Gene names  (ORF ):

Length:285

Mass:33010

Sequence:MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRSKHAQFGGFSYKKMTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKVLALFGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSLPPEAFYMIRFHSFYPWHTGRDYQQLCSQQDLAMLPWVREFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCPGILSW

Tissue specificity:Kidney specific.

Induction:

Developmental stage:

Protein families:Myo-inositol oxygenase family


   💬 WhatsApp