KAD3_HUMAN   Q9UIJ7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UIJ7

Recommended name:GTP:AMP phosphotransferase AK3, mitochondrial

EC number:EC:2.7.4.10

Alternative names:(Adenylate kinase 3) (AK 3) (Adenylate kinase 3 alpha-like 1)

Cleaved into:

GeneID:50808

Gene names  (primary ):AK3

Gene names  (synonym ):AK3L1 AK6 AKL3L

Gene names  (ORF ):

Length:227

Mass:25565

Sequence:MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP

Tissue specificity:Highly expressed in heart, skeletal muscle and liver, moderately expressed in pancreas and kidney, and weakly expressed in placenta, brain and lung. {ECO:0000269|PubMed:11485571}.

Induction:

Developmental stage:

Protein families:Adenylate kinase family, AK3 subfamily


   💬 WhatsApp