ZDHC3_HUMAN Q9NYG2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NYG2
Recommended name：Palmitoyltransferase ZDHHC3
EC number：EC:2.3.1.225
Alternative names：(Acyltransferase ZDHHC3) (Protein DHHC1) (Zinc finger DHHC domain-containing protein 3) (DHHC-3)
Cleaved into：
GeneID：51304
Gene names (primary )：ZDHHC3
Gene names (synonym )：
Gene names (ORF )：HSD49
Length：299
Mass：34170
Sequence：MMLIPTHHFRNIERKPEYLQPEKCVPPPYPGPVGTMWFIRDGCGIACAIVTWFLVLYAEFVVLFVMLIPSRDYVYSIINGIVFNLLAFLALASHCRAMLTDPGAVPKGNATKEFIESLQLKPGQVVYKCPKCCSIKPDRAHHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYIALISLHALIMVGFHFLHCFEEDWTKCSSFSPPTTVILLILLCFEGLLFLIFTSVMFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASPFATPDQGKADPYQYVV
Tissue specificity：Widely expressed with significant expression in heart, lung, liver, skeletal muscle, kidney, testis, thymus, small intestine and leukocyte. {ECO:0000269|PubMed:16647879}.
Induction：
Developmental stage：
Protein families：DHHC palmitoyltransferase family