ACYP1_HUMAN   P07311


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P07311

Recommended name:Acylphosphatase-1

EC number:EC:3.6.1.7

Alternative names:(Acylphosphatase, erythrocyte isozyme) (Acylphosphatase, organ-common type isozyme) (Acylphosphate phosphohydrolase 1)

Cleaved into:

GeneID:97

Gene names  (primary ):ACYP1

Gene names  (synonym ):ACYPE

Gene names  (ORF ):

Length:99

Mass:11261

Sequence:MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK

Tissue specificity:Organ-common type isozyme is found in many different tissues.

Induction:

Developmental stage:

Protein families:Acylphosphatase family