MOGT1_HUMAN   Q96PD6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96PD6

Recommended name:2-acylglycerol O-acyltransferase 1

EC number:EC:2.3.1.22

Alternative names:(Acyl-CoA:monoacylglycerol acyltransferase 1) (MGAT1) (Diacylglycerol O-acyltransferase candidate 2) (hDC2) (Diacylglycerol acyltransferase 2-like protein 1) (Monoacylglycerol O-acyltransferase 1)

Cleaved into:

GeneID:116255

Gene names  (primary ):MOGAT1

Gene names  (synonym ):DC2 DGAT2L1

Gene names  (ORF ):

Length:335

Mass:38812

Sequence:MKVEFAPLNIQLARRLQTVAVLQWVLKYLLLGPMSIGITVMLIIHNYLFLYIPYLMWLYFDWHTPERGGRRSSWIKNWTLWKHFKDYFPIHLIKTQDLDPSHNYIFGFHPHGIMAVGAFGNFSVNYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGNISVIVLGGAKESLDAHPGKFTLFIRQRKGFVKIALTHGASLVPVVSFGENELFKQTDNPEGSWIRTVQNKLQKIMGFALPLFHARGVFQYNFGLMTYRKAIHTVVGRPIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK

Tissue specificity:Expressed in stomach and liver. {ECO:0000269|PubMed:12621063}.

Induction:

Developmental stage:

Protein families:Diacylglycerol acyltransferase family


   💬 WhatsApp