GLYL2_HUMAN   Q8WU03


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8WU03

Recommended name:Glycine N-acyltransferase-like protein 2

EC number:EC:2.3.1.13

Alternative names:(Acyl-CoA:glycine N-acyltransferase-like protein 2)

Cleaved into:

GeneID:219970

Gene names  (primary ):GLYATL2

Gene names  (synonym ):

Gene names  (ORF ):

Length:294

Mass:34277

Sequence:MLVLHNSQKLQILYKSLEKSIPESIKVYGAIFNIKDKNPFNMEVLVDAWPDYQIVITRPQKQEMKDDQDHYTNTYHIFTKAPDKLEEVLSYSNVISWEQTLQIQGCQEGLDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNKEGNFSNMFLDASHAGLVNEHWAFGKNERSLKYIERCLQDFLGFGVLGPEGQLVSWIVMEQSCELRMGYTVPKYRHQGNMLQIGYHLEKYLSQKEIPFYFHVADNNEKSLQALNNLGFKICPCGWHQWKCTPKKYC

Tissue specificity:Expressed at highest levels in salivary gland and trachea. Also detected in thyroid gland, spinal cord, prostate, lung and fetal brain. {ECO:0000269|PubMed:20305126}.

Induction:

Developmental stage:

Protein families:Glycine N-acyltransferase family


   💬 WhatsApp