HACD4_HUMAN Q5VWC8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5VWC8
Recommended name：Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4
EC number：EC:4.2.1.134
Alternative names：(3-hydroxyacyl-CoA dehydratase 4) (HACD4) (Protein-tyrosine phosphatase-like A domain-containing protein 2)
Cleaved into：
GeneID：401494
Gene names (primary )：HACD4
Gene names (synonym )：PTPLAD2
Gene names (ORF )：
Length：232
Mass：27520
Sequence：MGPLALPAWLQPRYRKNAYLFIYYLIQFCGHSWIFTNMTVRFFSFGKDSMVDTFYAIGLVMRLCQSVSLLELLHIYVGIESNHLLPRFLQLTERIIILFVVITSQEEVQEKYVVCVLFVFWNLLDMVRYTYSMLSVIGISYAVLTWLSQTLWMPIYPLCVLAEAFAIYQSLPYFESFGTYSTKLPFDLSIYFPYVLKIYLMMLFIGMYFTYSHLYSERRDILGIFPIKKKKM
Tissue specificity：Highly expressed in leukocytes, and low expression in heart, spleen, kidney, and placenta. {ECO:0000269|PubMed:18554506}.
Induction：
Developmental stage：
Protein families：Very long-chain fatty acids dehydratase HACD family