HTAI2_HUMAN Q9BUP3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BUP3
Recommended name：Oxidoreductase HTATIP2
EC number：EC:1.1.1.-
Alternative names：(30 kDa HIV-1 TAT-interacting protein) (HIV-1 TAT-interactive protein 2)
Cleaved into：
GeneID：10553
Gene names (primary )：HTATIP2
Gene names (synonym )：CC3 TIP30
Gene names (ORF )：
Length：242
Mass：27049
Sequence：MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWASGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP
Tissue specificity：Ubiquitous. Highest level in liver. High levels in lung, skeletal muscle, pancreas and placenta. Moderate levels in heart and kidney. Low levels in brain. Not expressed or low levels in variant small cell lung carcinomas, 33% of hepatocellular carcinomas and neuroblastomas. {ECO:0000269|PubMed:14695192, ECO:0000269|PubMed:9174052}.
Induction：
Developmental stage：
Protein families：