ABHD2_HUMAN P08910
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P08910
Recommended name：Monoacylglycerol lipase ABHD2
EC number：EC:3.1.1.23
Alternative names：(2-arachidonoylglycerol hydrolase) (Abhydrolase domain-containing protein 2) (Acetylesterase) (Lung alpha/beta hydrolase 2) (Progesterone-sensitive lipase) (Protein PHPS1-2)
Cleaved into：
GeneID：11057
Gene names (primary )：ABHD2
Gene names (synonym )：LABH2
Gene names (ORF )：
Length：425
Mass：48315
Sequence：MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCPLLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEHCVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFGAMVNYIKKTYPLTQLVVVGFSLGGNIVCKYLGETQANQEKVLCCVSVCQGYSALRAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHVKKPQSLEDTDLSRLYTATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIPKSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKLQCSDTEQVEADLE
Tissue specificity：Present in sperm (at protein level). {ECO:0000269|PubMed:26989199}.
Induction：
Developmental stage：
Protein families：AB hydrolase superfamily, AB hydrolase 4 family