CBR1_HUMAN P16152
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P16152
Recommended name：Carbonyl reductase [NADPH] 1
EC number：EC:1.1.1.184
Alternative names：(15-hydroxyprostaglandin dehydrogenase [NADP(+)]) (20-beta-hydroxysteroid dehydrogenase) (NADPH-dependent carbonyl reductase 1) (Prostaglandin 9-ketoreductase) (PG-9-KR) (Prostaglandin-E(2) 9-reductase) (Short chain dehydrogenase/reductase family 21C member 1)
Cleaved into：
GeneID：873
Gene names (primary )：CBR1
Gene names (synonym )：CBR CRN SDR21C1
Gene names (ORF )：
Length：277
Mass：30375
Sequence：MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Tissue specificity：Expressed in kidney (at protein level). {ECO:0000269|PubMed:1597188}.
Induction：
Developmental stage：
Protein families：Short-chain dehydrogenases/reductases (SDR) family