UB2D3_HUMAN P61077
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61077
Recommended name：Ubiquitin-conjugating enzyme E2 D3
EC number：EC:2.3.2.23
Alternative names：((E3-independent) E2 ubiquitin-conjugating enzyme D3) (E2 ubiquitin-conjugating enzyme D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2(17)KB 3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (Ubiquitin-protein ligase D3)
Cleaved into：
GeneID：7323
Gene names (primary )：UBE2D3
Gene names (synonym )：UBC5C UBCH5C
Gene names (ORF )：
Length：147
Mass：16687
Sequence：MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM
Tissue specificity：
Induction：
Developmental stage：
Protein families：Ubiquitin-conjugating enzyme family