DUS14_HUMAN O95147
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O95147
Recommended name：Dual specificity protein phosphatase 14
EC number：EC:3.1.3.16
Alternative names：(MKP-1-like protein tyrosine phosphatase) (MKP-L) (Mitogen-activated protein kinase phosphatase 6) (MAP kinase phosphatase 6) (MKP-6)
Cleaved into：
GeneID：11072
Gene names (primary )：DUSP14
Gene names (synonym )：MKP6
Gene names (ORF )：
Length：198
Mass：22255
Sequence：MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI
Tissue specificity：
Induction：
Developmental stage：
Protein families：Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily