DUS21_HUMAN Q9H596
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9H596
Recommended name：Dual specificity protein phosphatase 21
EC number：EC:3.1.3.16
Alternative names：(Low molecular weight dual specificity phosphatase 21) (LMW-DSP21)
Cleaved into：
GeneID：63904
Gene names (primary )：DUSP21
Gene names (synonym )：LMWDSP21
Gene names (ORF )：
Length：190
Mass：21529
Sequence：MTASASSFSSSQGVQQPSIYSFSQITRSLFLSNGVAANDKLLLSSNRITAIVNASVEVVNVFFEGIQYIKVPVTDARDSRLYDFFDPIADLIHTIDMRQGRTLLHCMAGVSRSASLCLAYLMKYHSMSLLDAHTWTKSRRPIIRPNNGFWEQLINYEFKLFNNNTVRMINSPVGNIPDIYEKDLRMMISM
Tissue specificity：Expressed in testis. {ECO:0000269|PubMed:12408986}.
Induction：
Developmental stage：
Protein families：Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily