DUS18_HUMAN Q8NEJ0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8NEJ0
Recommended name：Dual specificity protein phosphatase 18
EC number：EC:3.1.3.16
Alternative names：(Low molecular weight dual specificity phosphatase 20) (LMW-DSP20)
Cleaved into：
GeneID：150290
Gene names (primary )：DUSP18
Gene names (synonym )：LMWDSP20
Gene names (ORF )：
Length：188
Mass：21066
Sequence：MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVPVADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPL
Tissue specificity：Widely expressed with highest levels in liver, brain, ovary and testis. {ECO:0000269|PubMed:12408986, ECO:0000269|PubMed:12591617}.
Induction：
Developmental stage：
Protein families：Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily