DUS23_HUMAN Q9BVJ7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BVJ7
Recommended name：Dual specificity protein phosphatase 23
EC number：EC:3.1.3.16
Alternative names：(Low molecular mass dual specificity phosphatase 3) (LDP-3) (VH1-like phosphatase Z)
Cleaved into：
GeneID：54935
Gene names (primary )：DUSP23
Gene names (synonym )：LDP3 VHZ
Gene names (ORF )：
Length：150
Mass：16588
Sequence：MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK
Tissue specificity：Widely expressed. Highly expressed in spleen, prostate, colon, adrenal gland, mammary gland, thyroid and trachea. Expressed at lower level in uterus, small intestine, bladder, bone marrow, brain, spinal cord and stomach. {ECO:0000269|PubMed:15147733, ECO:0000269|PubMed:15201283}.
Induction：
Developmental stage：
Protein families：Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily