DUS3_HUMAN   P51452


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P51452

Recommended name:Dual specificity protein phosphatase 3

EC number:EC:3.1.3.16

Alternative names:(Dual specificity protein phosphatase VHR) (Vaccinia H1-related phosphatase) (VHR)

Cleaved into:

GeneID:1845

Gene names  (primary ):DUSP3

Gene names  (synonym ):VHR

Gene names  (ORF ):

Length:185

Mass:20478

Sequence:MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP

Tissue specificity:

Induction:

Developmental stage:

Protein families:Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily


   💬 WhatsApp