PGAM2_HUMAN   P15259


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P15259

Recommended name:Phosphoglycerate mutase 2

EC number:EC:5.4.2.11

Alternative names:(BPG-dependent PGAM 2) (Muscle-specific phosphoglycerate mutase) (Phosphoglycerate mutase isozyme M) (PGAM-M)

Cleaved into:

GeneID:5224

Gene names  (primary ):PGAM2

Gene names  (synonym ):PGAMM

Gene names  (ORF ):

Length:253

Mass:28766

Sequence:MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTIARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVYELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK

Tissue specificity:Expressed in the heart and muscle. Not found in the liver and brain. {ECO:0000269|PubMed:2822696}.

Induction:

Developmental stage:

Protein families:Phosphoglycerate mutase family, BPG-dependent PGAM subfamily


   💬 WhatsApp