PGAM1_HUMAN   P18669


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P18669

Recommended name:Phosphoglycerate mutase 1

EC number:EC:5.4.2.11

Alternative names:(BPG-dependent PGAM 1) (Phosphoglycerate mutase isozyme B) (PGAM-B)

Cleaved into:

GeneID:5223

Gene names  (primary ):PGAM1

Gene names  (synonym ):PGAMA

Gene names  (ORF ):CDABP0006

Length:254

Mass:28804

Sequence:MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK

Tissue specificity:Expressed in the liver and brain. Not found in the muscle. {ECO:0000269|PubMed:2846553}.

Induction:

Developmental stage:

Protein families:Phosphoglycerate mutase family, BPG-dependent PGAM subfamily


   💬 WhatsApp