PLAT1_HUMAN   Q9HDD0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9HDD0

Recommended name:Phospholipase A and acyltransferase 1

EC number:EC:2.3.1.-

Alternative names:(HRAS-like suppressor 1) (HRSL1) (Phospholipid-metabolizing enzyme A-C1)

Cleaved into:

GeneID:57110

Gene names  (primary ):PLAAT1

Gene names  (synonym ):HRASLS

Gene names  (ORF ):

Length:168

Mass:18750

Sequence:MAFNDCFSLNYPGNPCPGDLIEVFRPGYQHWALYLGDGYVINIAPVDGIPASFTSAKSVFSSKALVKMQLLKDVVGNDTYRINNKYDETYPPLPVEEIIKRSEFVIGQEVAYNLLVNNCEHFVTLLRYGEGVSEQANRAISTVEFVTAAVGVFSFLGLFPKGQRAKYY

Tissue specificity:[Isoform 1]: Abundantly expressed in testis, skeletal muscle, brain, and heart. {ECO:0000269|PubMed:21880860}.; [Isoform 2]: Highly expressed in the testis, skeletal muscle, brain, heart, and thyroid. {ECO:0000269|PubMed:27623847}.

Induction:

Developmental stage:

Protein families:H-rev107 family


   💬 WhatsApp