ZN683_HUMAN Q8IZ20
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8IZ20
Recommended name：Tissue-resident T-cell transcription regulator protein ZNF683
EC number：
Alternative names：(Homolog of Blimp-1 in T-cell) (Hobit) (Zinc finger protein 683)
Cleaved into：
GeneID：257101
Gene names (primary )：ZNF683
Gene names (synonym )：
Gene names (ORF )：
Length：524
Mass：56905
Sequence：MKEESAAQLGCCHRPMALGGTGGSLSPSLDFQLFRGDQVFSACRPLPDMVDAHGPSCASWLCPLPLAPGRSALLACLQDLDLNLCTPQPAPLGTDLQGLQEDALSMKHEPPGLQASSTDDKKFTVKYPQNKDKLGKQPERAGEGAPCPAFSSHNSSSPPPLQNRKSPSPLAFCPCPPVNSISKELPFLLHAFYPGYPLLLPPPHLFTYGALPSDQCPHLLMLPQDPSYPTMAMPSLLMMVNELGHPSARWETLLPYPGAFQASGQALPSQARNPGAGAAPTDSPGLERGGMASPAKRVPLSSQTGTAALPYPLKKKNGKILYECNICGKSFGQLSNLKVHLRVHSGERPFQCALCQKSFTQLAHLQKHHLVHTGERPHKCSIPWVPGRNHWKSFQAWREREVCHKRFSSSSNLKTHLRLHSGARPFQCSVCRSRFTQHIHLKLHHRLHAPQPCGLVHTQLPLASLACLAQWHQGALDLMAVASEKHMGYDIDEVKVSSTSQGKARAVSLSSAGTPLVMGQDQNN
Tissue specificity：Expressed in terminally differentiated effector CD8(+) T-cells, but not in naive and central memory cells (PubMed:26179882). Expressed in terminally differentiated natural killer (NK) cells and natural killer (NKT) T-cells (at protein level) (PubMed:26179882). Expressed strongly in effector-type CD8(+) T-cells and weakly in naive and memory CD8(+) T-cells (PubMed:26179882). Expressed in terminally differentiated natural killer (NK) cells (PubMed:26179882). Isoform 2 is strongly expressed in effector CD8(+) T and natural killer (NK) cells (PubMed:26179882). Isoform 1 is expressed in effector CD8(+) T and natural killer (NK) cells (PubMed:26179882). {ECO:0000269|PubMed:26179882}.; (Microbial infection) Expressed in cytomegalovirus (CMV)-infected effector CD8(+) T-cells (at protein level) (PubMed:20921622). {ECO:0000269|PubMed:20921622}.
Induction：(Microbial infection) Up-regulated by cytomegalovirus (CMV) infection in long-lived effector CD8(+) T-cells (PubMed:20921622). {ECO:0000269|PubMed:20921622}.
Developmental stage：
Protein families：Krueppel C2H2-type zinc-finger protein family