SNG2_HUMAN   O43760


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O43760

Recommended name:Synaptogyrin-2

EC number:

Alternative names:(Cellugyrin)

Cleaved into:

GeneID:9144

Gene names  (primary ):SYNGR2

Gene names  (synonym ):

Gene names  (ORF ):UNQ352/PRO615

Length:224

Mass:24810

Sequence:MESGAYGAAKAGGSFDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNAHESKQMYCVFNRNEDACRYGSAIGVLAFLASAFFLVVDAYFPQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAVTNPKDVLVGADSVRAAITFSFFSIFSWGVLASLAYQRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQPPPVY

Tissue specificity:Ubiquitous; low expression in brain. {ECO:0000269|PubMed:9760194}.

Induction:(Microbial infection) Up-regulated upon SFTS phlebovirus infection (at protein level). {ECO:0000269|PubMed:27226560}.

Developmental stage:

Protein families:Synaptogyrin family


   💬 WhatsApp