AIFM1_HUMAN O95831
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O95831
Recommended name：Apoptosis-inducing factor 1, mitochondrial
EC number：EC:1.6.99.-
Alternative names：(Programmed cell death protein 8)
Cleaved into：
GeneID：9131
Gene names (primary )：AIFM1
Gene names (synonym )：AIF PDCD8
Gene names (ORF )：
Length：613
Mass：66901
Sequence：MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGASGGKIDNSVLVLIVGLSTVGAGAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED
Tissue specificity：Expressed in all tested tissues (PubMed:16644725). Detected in muscle and skin fibroblasts (at protein level) (PubMed:23217327). Expressed in osteoblasts (at protein level) (PubMed:28842795). {ECO:0000269|PubMed:16644725, ECO:0000269|PubMed:23217327, ECO:0000269|PubMed:28842795}.; [Isoform 3]: Brain specific. {ECO:0000269|PubMed:20111043}.; [Isoform 4]: Expressed in all tested tissues except brain. {ECO:0000269|PubMed:16644725}.; [Isoform 5]: Isoform 5 is frequently down-regulated in human cancers. {ECO:0000269|PubMed:16365034}.
Induction：[Isoform 5]: Strongly down-regulated in many tumor cells, up-regulated by gamma-irradiation. {ECO:0000269|PubMed:16365034}.
Developmental stage：
Protein families：FAD-dependent oxidoreductase family