PROK2_HUMAN Q9HC23
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9HC23
Recommended name：Prokineticin-2
EC number：
Alternative names：(PK2) (Protein Bv8 homolog)
Cleaved into：
GeneID：60675
Gene names (primary )：PROK2
Gene names (synonym )：BV8
Gene names (ORF )：
Length：129
Mass：14314
Sequence：MRSLCCAPLLLLLLLPPLLLTPRAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK
Tissue specificity：Expressed in the testis and, at low levels, in the small intestine.
Induction：Activated by CLOCK and BMAL1 heterodimers and light; inhibited by period genes (PER1, PER2 and PER3) and cryptochrome genes (CRY1 and CRY2). {ECO:0000305}.
Developmental stage：
Protein families：AVIT (prokineticin) family