GOLP3_HUMAN Q9H4A6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9H4A6
Recommended name：Golgi phosphoprotein 3
EC number：
Alternative names：(Coat protein GPP34) (Mitochondrial DNA absence factor) (MIDAS)
Cleaved into：
GeneID：64083
Gene names (primary )：GOLPH3
Gene names (synonym )：GPP34
Gene names (ORF )：
Length：298
Mass：33811
Sequence：MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK
Tissue specificity：Detected in muscle fibers of patients with mitochondrial diseases; not detected in normal muscle fibers.
Induction：Activated by depletion of mitochondrial DNA.
Developmental stage：
Protein families：GOLPH3/VPS74 family