RALA_HUMAN P11233
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P11233
Recommended name：Ras-related protein Ral-A
EC number：EC:3.6.5.2
Alternative names：
Cleaved into：
GeneID：5898
Gene names (primary )：RALA
Gene names (synonym )：RAL
Gene names (ORF )：
Length：206
Mass：23567
Sequence：MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL
Tissue specificity：
Induction：Activated in an LPA-dependent manner by LPAR1 and in an LPA-independent manner by LPAR2. {ECO:0000269|PubMed:19306925}.
Developmental stage：
Protein families：Small GTPase superfamily, Ras family