REG3A_HUMAN Q06141
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q06141
Recommended name：Regenerating islet-derived protein 3-alpha
EC number：
Alternative names：(REG-3-alpha) (Hepatointestinal pancreatic protein) (HIP/PAP) (Human proislet peptide) (Pancreatitis-associated protein 1) (Regenerating islet-derived protein III-alpha) (Reg III-alpha)
Cleaved into：Regenerating islet-derived protein 3-alpha 16.5 kDa form; Regenerating islet-derived protein 3-alpha 15 kDa form
GeneID：5068
Gene names (primary )：REG3A
Gene names (synonym )：HIP PAP PAP1
Gene names (ORF )：
Length：175
Mass：19395
Sequence：MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
Tissue specificity：Highly expressed in epidermal keratinocytes of psoriasis patients (at protein level). Constitutively expressed in intestine. Low expression is found in healthy pancreas. Overexpressed during the acute phase of pancreatitis and in some patients with chronic pancreatitis. {ECO:0000269|PubMed:1469087, ECO:0000269|PubMed:22727489}.
Induction：Appears in pancreatic juice after induction of pancreatic inflammation.
Developmental stage：
Protein families：