H10_HUMAN   P07305


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P07305

Recommended name:Histone H1.0

EC number:

Alternative names:(Histone H1') (Histone H1(0))

Cleaved into:Histone H1.0, N-terminally processed

GeneID:3005

Gene names  (primary ):H1-0

Gene names  (synonym ):H1F0 H1FV

Gene names  (ORF ):

Length:194

Mass:20863

Sequence:MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK

Tissue specificity:

Induction:Both the unedited and the RNA edited versions are induced by butyrate (at protein level). Only RNA edited version is induced by DTT, vinblastine or TNF (at protein level). {ECO:0000269|PubMed:18993075}.

Developmental stage:

Protein families:Histone H1/H5 family


   💬 WhatsApp