RBX2_HUMAN   Q9UBF6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UBF6

Recommended name:RING-box protein 2

EC number:

Alternative names:(Rbx2) (CKII beta-binding protein 1) (CKBBP1) (RING finger protein 7) (Regulator of cullins 2) (Sensitive to apoptosis gene protein)

Cleaved into:

GeneID:9616

Gene names  (primary ):RNF7

Gene names  (synonym ):RBX2 ROC2 SAG

Gene names  (ORF ):

Length:113

Mass:12683

Sequence:MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK

Tissue specificity:Expressed in heart, liver, skeletal muscle and pancreas. At very low levels expressed in brain, placenta and lung. {ECO:0000269|PubMed:10512750}.

Induction:By 1,10-phenanthroline. {ECO:0000269|PubMed:10082581}.

Developmental stage:

Protein families:RING-box family


   💬 WhatsApp