T53I1_HUMAN Q96A56
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96A56
Recommended name：Tumor protein p53-inducible nuclear protein 1
EC number：
Alternative names：(Stress-induced protein) (p53-dependent damage-inducible nuclear protein 1) (p53DINP1)
Cleaved into：
GeneID：94241
Gene names (primary )：TP53INP1
Gene names (synonym )：P53DINP1 SIP
Gene names (ORF )：
Length：240
Mass：27366
Sequence：MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPTEHPSVFSCLPASLECLADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEATRGTDELHSPSSPRVEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPCPRQYNY
Tissue specificity：Ubiquitously expressed. {ECO:0000269|PubMed:11511362, ECO:0000269|PubMed:12067065}.
Induction：By adriamycin, gamma irradiation and H(2)O(2), in a p53/TP53-dependent way. At lower levels by UV irradiation. By TP73. {ECO:0000269|PubMed:11511362, ECO:0000269|PubMed:12067065}.
Developmental stage：
Protein families：