SLAP1_HUMAN Q13239
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q13239
Recommended name：Src-like-adapter
EC number：
Alternative names：(Src-like-adapter protein 1) (SLAP-1) (hSLAP)
Cleaved into：
GeneID：6503
Gene names (primary )：SLA
Gene names (synonym )：SLAP SLAP1
Gene names (ORF )：
Length：276
Mass：31156
Sequence：MGNSMKSTPAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVNHYSEVADGLCCVLTTPCLTQSTAAPAVRASSSPVTLRQKTVDWRRVSRLQEDPEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGGSKRKSSFFSSPPYFED
Tissue specificity：Expressed in lung and fetal brain. Weakly expressed in heart, adult brain, placenta, liver, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:9660183}.
Induction：By all-trans retinoic acid (ATRA). Induction is indirect and is mediated through other proteins. {ECO:0000269|PubMed:9020066}.
Developmental stage：
Protein families：