PLAT4_HUMAN Q9UL19
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9UL19
Recommended name：Phospholipase A and acyltransferase 4
EC number：EC:2.3.1.-
Alternative names：(HRAS-like suppressor 4) (HRSL4) (RAR-responsive protein TIG3) (Retinoic acid receptor responder protein 3) (Retinoid-inducible gene 1 protein) (Tazarotene-induced gene 3 protein)
Cleaved into：
GeneID：5920
Gene names (primary )：PLAAT4
Gene names (synonym )：RARRES3 RIG1 TIG3
Gene names (ORF )：
Length：164
Mass：18179
Sequence：MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA
Tissue specificity：Widely expressed. {ECO:0000269|PubMed:10687848, ECO:0000269|PubMed:19615464}.
Induction：By all-trans-retinoic acid and synthetic retinoids. {ECO:0000269|PubMed:10687848}.
Developmental stage：
Protein families：H-rev107 family