TYB4_HUMAN P62328
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P62328
Recommended name:Thymosin beta-4
EC number:
Alternative names:(T beta-4) (Fx)
Cleaved into:Hematopoietic system regulatory peptide (Seraspenide)
GeneID:7114
Gene names (primary ):TMSB4X
Gene names (synonym ):TB4X THYB4 TMSB4
Gene names (ORF ):
Length:44
Mass:5053
Sequence:MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Tissue specificity:Expressed in several hemopoietic cell lines and lymphoid malignant cells. Decreased levels in myeloma cells. {ECO:0000269|PubMed:3500230}.
Induction:By alpha interferons. Decreased levels in THP-1 cells after treatment with recombinant interferon-lambda. {ECO:0000269|PubMed:3500230, ECO:0000269|PubMed:6548414}.
Developmental stage:
Protein families:Thymosin beta family