EAF2_HUMAN Q96CJ1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96CJ1
Recommended name：ELL-associated factor 2
EC number：
Alternative names：(Testosterone-regulated apoptosis inducer and tumor suppressor protein)
Cleaved into：
GeneID：55840
Gene names (primary )：EAF2
Gene names (synonym )：TRAITS
Gene names (ORF )：BM-040
Length：260
Mass：28792
Sequence：MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGSTPPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNLVKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSSDSKSSSSSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRDNSGLLMNTLRNDLQLSESGSDSDD
Tissue specificity：Expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, spleen, prostate, testis, small intestine, colon, adrenal, bone marrow, lymph node, spinal gland, stomach, thyroid, trachea, thymus, liver and leukocytes. {ECO:0000269|PubMed:12446457, ECO:0000269|PubMed:12907652}.
Induction：By androgen. {ECO:0000269|PubMed:12907652}.
Developmental stage：
Protein families：EAF family